Recombinant Human BMP8A Protein, GST-tagged
Cat.No. : | BMP8A-276H |
Product Overview : | Human BMP8A partial ORF ( NP_861525.1, 112 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.41 kDa |
AA Sequence : | VERDRALGHQEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLL |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMP8A bone morphogenetic protein 8a [ Homo sapiens ] |
Official Symbol | BMP8A |
Synonyms | BMP8A; bone morphogenetic protein 8a; bone morphogenetic protein 8A; BMP-8A; FLJ14351; FLJ45264; |
Gene ID | 353500 |
mRNA Refseq | NM_181809 |
Protein Refseq | NP_861525 |
UniProt ID | Q7Z5Y6 |
◆ Recombinant Proteins | ||
BMP8A-325H | Recombinant Human BMP8A Protein, His-tagged | +Inquiry |
BMP8A-161H | Active Recombinant Human BMP8A Protein (Ala264-His402), C-His tagged, Animal-free, Carrier-free | +Inquiry |
BMP8A-275H | Recombinant Human BMP8A Protein, GST-tagged | +Inquiry |
BMP8A-4060Z | Recombinant Zebrafish BMP8A | +Inquiry |
BMP8A-591H | Active Recombinant Human Bone Morphogenetic Protein 8a | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP8A Products
Required fields are marked with *
My Review for All BMP8A Products
Required fields are marked with *