Recombinant Human BMP8A Protein, GST-tagged
| Cat.No. : | BMP8A-276H |
| Product Overview : | Human BMP8A partial ORF ( NP_861525.1, 112 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | VERDRALGHQEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLFFLDLQTLRAGDEGWLVLDVTAASDCWLL |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BMP8A bone morphogenetic protein 8a [ Homo sapiens ] |
| Official Symbol | BMP8A |
| Synonyms | BMP8A; bone morphogenetic protein 8a; bone morphogenetic protein 8A; BMP-8A; FLJ14351; FLJ45264; |
| Gene ID | 353500 |
| mRNA Refseq | NM_181809 |
| Protein Refseq | NP_861525 |
| UniProt ID | Q7Z5Y6 |
| ◆ Recombinant Proteins | ||
| BMP8A-587H | Active Recombinant Human Bone Morphogenetic Protein 8a | +Inquiry |
| BMP8A-2551H | Recombinant Human BMP8A Protein, His (Fc)-Avi-tagged | +Inquiry |
| BMP8A-1309H | Recombinant Human BMP8A | +Inquiry |
| BMP8A-017H | Active Recombinant Human BMP8A Protein | +Inquiry |
| BMP8A-1729HF | Recombinant Full Length Human BMP8A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP8A Products
Required fields are marked with *
My Review for All BMP8A Products
Required fields are marked with *
