Recombinant Human BMP8B

Cat.No. : BMP8B-27490TH
Product Overview : Recombinant fragment of Human BMP8 with a N terminal proprietary tag; Predicted MW 35.42 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Description : The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has led to speculation of possible bone inductive activity.
Molecular Weight : 35.420kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
Sequence Similarities : Belongs to the TGF-beta family.
Gene Name BMP8B bone morphogenetic protein 8b [ Homo sapiens ]
Official Symbol BMP8B
Synonyms BMP8B; bone morphogenetic protein 8b; BMP8, bone morphogenetic protein 8 (osteogenic protein 2); bone morphogenetic protein 8B; OP 2; osteogenic protein 2;
Gene ID 656
mRNA Refseq NM_001720
Protein Refseq NP_001711
MIM 602284
Uniprot ID P34820
Chromosome Location 1p35-p32
Pathway Hedgehog signaling pathway, organism-specific biosystem; Hedgehog signaling pathway, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function cytokine activity; growth factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP8B Products

Required fields are marked with *

My Review for All BMP8B Products

Required fields are marked with *

0
cart-icon