Recombinant Mouse BMP8B Protein (261-399 aa), His-SUMO-tagged
Cat.No. : | BMP8B-2692M |
Product Overview : | Recombinant Mouse BMP8B Protein (261-399 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 261-399 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.7 kDa |
AA Sequence : | TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Bmp8b bone morphogenetic protein 8b [ Mus musculus ] |
Official Symbol | BMP8B |
Synonyms | BMP8B; bone morphogenetic protein 8b; bone morphogenetic protein 8B; BMP-8B; Op3; |
Gene ID | 12164 |
mRNA Refseq | NM_007559 |
Protein Refseq | NP_031585 |
UniProt ID | P55105 |
◆ Recombinant Proteins | ||
BMP8B-2436M | Recombinant Mouse BMP8B Protein | +Inquiry |
BMP8B-2692M | Recombinant Mouse BMP8B Protein (261-399 aa), His-SUMO-tagged | +Inquiry |
BMP8B-18H | Recombinant Human BMP8B, His-tagged | +Inquiry |
BMP8B-283H | Active Recombinant Human BMP8B Protein (Ala264-His402), N-His tagged, Animal-free, Carrier-free | +Inquiry |
BMP8B-1056M | Recombinant Mouse BMP8B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP8B-8428HCL | Recombinant Human BMP8B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP8B Products
Required fields are marked with *
My Review for All BMP8B Products
Required fields are marked with *
0
Inquiry Basket