Recombinant Mouse BMP8B Protein (261-399 aa), His-SUMO-tagged

Cat.No. : BMP8B-2692M
Product Overview : Recombinant Mouse BMP8B Protein (261-399 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 261-399 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 28.7 kDa
AA Sequence : TARPLKKKQLNQINQLPHSNKHLGILDDGHGSHGREVCRRHELYVSFRDLGWLDSVIAPQGYSAYYCAGECIYPLNSCMNSTNHATMQALVHLMKPDIIPKVCCVPTELSAISLLYYDRNNNVILRRERNMVVQACGCH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Bmp8b bone morphogenetic protein 8b [ Mus musculus ]
Official Symbol BMP8B
Synonyms BMP8B; bone morphogenetic protein 8b; bone morphogenetic protein 8B; BMP-8B; Op3;
Gene ID 12164
mRNA Refseq NM_007559
Protein Refseq NP_031585
UniProt ID P55105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP8B Products

Required fields are marked with *

My Review for All BMP8B Products

Required fields are marked with *

0
cart-icon
0
compare icon