Recombinant Human BMPR2 protein, His-tagged

Cat.No. : BMPR2-10258H
Product Overview : Recombinant Human BMPR2 protein(172-504 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability November 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 172-504 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) [ Homo sapiens ]
Official Symbol BMPR2
Synonyms BMPR2; bone morphogenetic protein receptor, type II (serine/threonine kinase); PPH1, primary pulmonary hypertension 1; bone morphogenetic protein receptor type-2; BMPR II; BMPR3; BRK 3; T ALK; BMPR-2; BMP type-2 receptor; BMP type II receptor; type II activin receptor-like kinase; bone morphogenetic protein receptor type II; type II receptor for bone morphogenetic protein-4; BMR2; PPH1; BRK-3; T-ALK; BMPR-II; FLJ41585; FLJ76945;
Gene ID 659
mRNA Refseq NM_001204
Protein Refseq NP_001195
MIM 600799
UniProt ID Q13873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMPR2 Products

Required fields are marked with *

My Review for All BMPR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon