Recombinant Human BMPR2 protein, His-tagged
| Cat.No. : | BMPR2-10258H |
| Product Overview : | Recombinant Human BMPR2 protein(172-504 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | May 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 172-504 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) [ Homo sapiens ] |
| Official Symbol | BMPR2 |
| Synonyms | BMPR2; bone morphogenetic protein receptor, type II (serine/threonine kinase); PPH1, primary pulmonary hypertension 1; bone morphogenetic protein receptor type-2; BMPR II; BMPR3; BRK 3; T ALK; BMPR-2; BMP type-2 receptor; BMP type II receptor; type II activin receptor-like kinase; bone morphogenetic protein receptor type II; type II receptor for bone morphogenetic protein-4; BMR2; PPH1; BRK-3; T-ALK; BMPR-II; FLJ41585; FLJ76945; |
| Gene ID | 659 |
| mRNA Refseq | NM_001204 |
| Protein Refseq | NP_001195 |
| MIM | 600799 |
| UniProt ID | Q13873 |
| ◆ Recombinant Proteins | ||
| BMPR2-1060M | Recombinant Mouse BMPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BMPR2-868H | Recombinant Human BMPR2 Protein, His-tagged | +Inquiry |
| Bmpr2-715M | Recombinant Mouse Bmpr2 Protein, MYC/DDK-tagged | +Inquiry |
| BMPR2-10258H | Recombinant Human BMPR2 protein, His-tagged | +Inquiry |
| BMPR2-556H | Active Recombinant Human BMPR2, Fc-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMPR2-2717HCL | Recombinant Human BMPR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMPR2 Products
Required fields are marked with *
My Review for All BMPR2 Products
Required fields are marked with *
