Recombinant Human BSG
| Cat.No. : | BSG-27216TH |
| Product Overview : | Recombinant fragment of Human CD147 (amino acids 206-305) with N terminal proprietary tag, 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTS |
| Sequence Similarities : | Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
| Gene Name | BSG basigin (Ok blood group) [ Homo sapiens ] |
| Official Symbol | BSG |
| Synonyms | BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN; |
| Gene ID | 682 |
| mRNA Refseq | NM_001728 |
| Protein Refseq | NP_001719 |
| MIM | 109480 |
| Uniprot ID | P35613 |
| Chromosome Location | 19p13.3 |
| Pathway | Basigin interactions, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem; |
| Function | lactate transmembrane transporter activity; mannose binding; sugar binding; |
| ◆ Recombinant Proteins | ||
| RFL559RF | Recombinant Full Length Rat Basigin(Bsg) Protein, His-Tagged | +Inquiry |
| BSG-9798Z | Recombinant Zebrafish BSG | +Inquiry |
| BSG-205H | Recombinant Human BSG protein, His/Myc-tagged | +Inquiry |
| BSG-1576R | Recombinant Rhesus Monkey BSG Protein | +Inquiry |
| BSG-3001H | Recombinant Human BSG Protein (Ala22-His205), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
| BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *



