Recombinant Human BSG
Cat.No. : | BSG-27216TH |
Product Overview : | Recombinant fragment of Human CD147 (amino acids 206-305) with N terminal proprietary tag, 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTS |
Sequence Similarities : | Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Gene Name | BSG basigin (Ok blood group) [ Homo sapiens ] |
Official Symbol | BSG |
Synonyms | BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN; |
Gene ID | 682 |
mRNA Refseq | NM_001728 |
Protein Refseq | NP_001719 |
MIM | 109480 |
Uniprot ID | P35613 |
Chromosome Location | 19p13.3 |
Pathway | Basigin interactions, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem; |
Function | lactate transmembrane transporter activity; mannose binding; sugar binding; |
◆ Recombinant Proteins | ||
Bsg-610M | Recombinant Mouse Bsg Protein, His-tagged | +Inquiry |
Bsg-611R | Recombinant Rat Bsg Protein, His-tagged | +Inquiry |
BSG-62H | Recombinant Human BSG protein(Met1-His205), hFc-tagged | +Inquiry |
BSG-012H | Active Recombinant Human BSG protein, His-tagged | +Inquiry |
BSG-2041H | Recombinant Human BSG Protein, Fc/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *