Recombinant Human BSG Protein(138-321aa), His-tagged

• Cat.No.: BSG-3874H
• Product Overview: Recombinant Human BSG Protein(138-321aa)(P35613), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 138-321aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.2kDa
• AA Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: BSG basigin (Ok blood group) [ Homo sapiens ]
• Official Symbol: BSG
• Synonyms: BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor; M6; OK; 5F7; TCSF
• Gene ID: 682
• mRNA Refseq: NM_001728
• Protein Refseq: NP_001719
• MIM: 109480
• UniProt ID: P35613