Recombinant Human BSG Protein(138-321aa), His-tagged
| Cat.No. : | BSG-3874H |
| Product Overview : | Recombinant Human BSG Protein(138-321aa)(P35613), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 138-321aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 24.2kDa |
| AA Sequence : | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | BSG basigin (Ok blood group) [ Homo sapiens ] |
| Official Symbol | BSG |
| Synonyms | BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor; M6; OK; 5F7; TCSF; |
| Gene ID | 682 |
| mRNA Refseq | NM_001728 |
| Protein Refseq | NP_001719 |
| MIM | 109480 |
| UniProt ID | P35613 |
| ◆ Recombinant Proteins | ||
| Bsg-610M | Recombinant Mouse Bsg Protein, His-tagged | +Inquiry |
| BSG-680R | Recombinant Rat BSG Protein, His (Fc)-Avi-tagged | +Inquiry |
| BSG-5119H | Recombinant Human BSG Protein (Met1-Phe205), C-His tagged | +Inquiry |
| BSG-606H | Active Recombinant Human CD147 Protein, His-tagged | +Inquiry |
| BSG-151H | Recombinant Human BSG Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
| BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *
