Recombinant Human BSG Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BSG-3338H |
Product Overview : | BSG MS Standard C13 and N15-labeled recombinant protein (NP_940993) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 22.6 kDa |
AA Sequence : | MKQSDASPQERVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BSG basigin (Ok blood group) [ Homo sapiens (human) ] |
Official Symbol | BSG |
Synonyms | BSG; basigin (Ok blood group); basigin (OK blood group), OK; basigin; CD147; EMMPRIN; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor; M6; OK; 5F7; TCSF; |
Gene ID | 682 |
mRNA Refseq | NM_198591 |
Protein Refseq | NP_940993 |
MIM | 109480 |
UniProt ID | P35613 |
◆ Recombinant Proteins | ||
BSG-1413H | Active Recombinant Human BSG protein, His-tagged, FITC-Labeled | +Inquiry |
BSG-134H | Recombinant Human BSG Protein, C-His-tagged | +Inquiry |
Bsg-2268M | Active Recombinant Mouse Bsg protein, His&hFc-tagged | +Inquiry |
BSG-1414H | Active Recombinant Human BSG protein, Fc-tagged | +Inquiry |
BSG-609H | Recombinant Human BSG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *