Recombinant Human BTLA protein, Fc/His-tagged
| Cat.No. : | BTLA-191H |
| Product Overview : | Recombinant Human BTLA(Lys31-Leu150) fused with Fc/His tag at C-terminal was expressed in HEK293. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc&His |
| Protein Length : | Lys31-Leu150 |
| Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
| AA Sequence : | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNI SFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDDIEGRMDE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens ] |
| Official Symbol | BTLA |
| Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
| Gene ID | 151888 |
| mRNA Refseq | NM_001085357 |
| Protein Refseq | NP_001078826 |
| MIM | 607925 |
| UniProt ID | Q7Z6A9 |
| Chromosome Location | 3q13.2 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| BTLA-27110TH | Recombinant Human BTLA, His-tagged | +Inquiry |
| BTLA-611H | Recombinant Human BTLA Protein | +Inquiry |
| BTLA-233HAF647 | Recombinant Human BTLA Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| BTLA-082H | Recombinant Human BTLA Protein (Lys31-Ser150), C-mFc and 6×His-tagged | +Inquiry |
| BTLA-1373C | Recombinant Cynomolgus BTLA protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
| BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *
