Recombinant Human BTLA protein, Fc/His-tagged
Cat.No. : | BTLA-191H |
Product Overview : | Recombinant Human BTLA(Lys31-Leu150) fused with Fc/His tag at C-terminal was expressed in HEK293. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | Lys31-Leu150 |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
AA Sequence : | KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNI SFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDDIEGRMDE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens ] |
Official Symbol | BTLA |
Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
Gene ID | 151888 |
mRNA Refseq | NM_001085357 |
Protein Refseq | NP_001078826 |
MIM | 607925 |
UniProt ID | Q7Z6A9 |
Chromosome Location | 3q13.2 |
Pathway | Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
BTLA-568H | Recombinant Human BTLA protein, His-Avi-tagged, Biotinylated | +Inquiry |
BTLA-611H | Recombinant Human BTLA Protein | +Inquiry |
BTLA-1148R | Active Recombinant Rat BTLA Protein, Fc-tagged | +Inquiry |
Btla-03M | Recombinant Mouse Btla Protein, hIgG/His-tagged | +Inquiry |
BTLA-8698MAF488 | Recombinant Mouse Btla Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *
0
Inquiry Basket