Recombinant Human C11orf86 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: C11orf86-5755H
• Product Overview: C11orf86 MS Standard C13 and N15-labeled recombinant protein (NP_001129957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: C11orf86 (Chromosome 11 Open Reading Frame 86) is a Protein Coding gene.
• Molecular Mass: 13 kDa
• AA Sequence: MGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLGDTEQLIQAQRRGSRWWLRRYQQVRRRWESFVAIFPSVTLSQPASPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: C11orf86 chromosome 11 open reading frame 86 [ Homo sapiens (human) ]
• Official Symbol: C11orf86
• Synonyms: C11orf86; chromosome 11 open reading frame 86; uncharacterized protein C11orf86
• Gene ID: 254439
• mRNA Refseq: NM_001136485
• Protein Refseq: NP_001129957
• UniProt ID: A6NJI1