Recombinant Human C1QA protein, His-SUMO-tagged
| Cat.No. : | C1QA-2606H | 
| Product Overview : | Recombinant Human C1QA protein(P02745)(23-245aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 23-245aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 39.7 kDa | 
| AA Sequence : | EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | C1QA complement component 1, q subcomponent, A chain [ Homo sapiens ] | 
| Official Symbol | C1QA | 
| Synonyms | C1QA; complement component 1, q subcomponent, A chain; complement component 1, q subcomponent, alpha polypeptide; complement C1q subcomponent subunit A; complement component C1q, A chain; | 
| Gene ID | 712 | 
| mRNA Refseq | NM_015991 | 
| Protein Refseq | NP_057075 | 
| MIM | 120550 | 
| UniProt ID | P02745 | 
| ◆ Recombinant Proteins | ||
| C1QA-1041R | Recombinant Rat C1QA Protein | +Inquiry | 
| C1QA-699R | Recombinant Rat C1QA Protein, His (Fc)-Avi-tagged | +Inquiry | 
| C1QA-2203H | Recombinant Human C1QA protein, His&Myc-tagged | +Inquiry | 
| C1qa-7933R | Recombinant Rat C1qa protein, His & T7-tagged | +Inquiry | 
| C1QA-925H | Recombinant Human C1QA Protein, His-tagged | +Inquiry | 
| ◆ Native Proteins | ||
| C1QA-26126TH | Native Human C1QA | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| C1QA-8143HCL | Recombinant Human C1QA 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QA Products
Required fields are marked with *
My Review for All C1QA Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            