Recombinant Mouse C1qa protein, His-tagged
| Cat.No. : | C1qa-2609M |
| Product Overview : | Recombinant Mouse C1qa protein(P98086)(23-245aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 23-245aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.1 kDa |
| AA Sequence : | EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | C1qa complement component 1, q subcomponent, alpha polypeptide [ Mus musculus ] |
| Official Symbol | C1qa |
| Synonyms | C1QA; complement component 1, q subcomponent, alpha polypeptide; complement C1q subcomponent subunit A; C1q; AI255395; |
| Gene ID | 12259 |
| mRNA Refseq | NM_007572 |
| Protein Refseq | NP_031598 |
| ◆ Recombinant Proteins | ||
| C1QA-926H | Recombinant human C1QA protein, His-tagged | +Inquiry |
| C1QA-2203H | Recombinant Human C1QA protein, His&Myc-tagged | +Inquiry |
| C1QA-333H | Recombinant Human C1QA Protein, His-tagged | +Inquiry |
| C1QA-2722Z | Recombinant Zebrafish C1QA | +Inquiry |
| C1QA-1041R | Recombinant Rat C1QA Protein | +Inquiry |
| ◆ Native Proteins | ||
| C1QA-26126TH | Native Human C1QA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| C1QA-8143HCL | Recombinant Human C1QA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1qa Products
Required fields are marked with *
My Review for All C1qa Products
Required fields are marked with *
