Recombinant human C1QC protein, His/GST-tagged
Cat.No. : | C1QC-927H |
Product Overview : | Recombinant C1QC protein(Lys117-Asp245), fused to His/GST-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 129 |
Description : | This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. |
Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Molecular Mass : | 44 kDa |
AA Sequence : | KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 95% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Gene Name | C1QC |
Official Symbol | C1QC |
Synonyms | C1QG; C1Q-C |
Gene ID | 714 |
mRNA Refseq | NM_001114101.3 |
Protein Refseq | NP_001107573.1 |
MIM | 120575 |
UniProt ID | P02747 |
◆ Recombinant Proteins | ||
C1QC-1133M | Recombinant Mouse C1QC Protein, His (Fc)-Avi-tagged | +Inquiry |
C1QC-0480H | Recombinant Human C1QC Protein (Lys115-Asp245), N-His-tagged | +Inquiry |
C1QC-1044R | Recombinant Rat C1QC Protein | +Inquiry |
C1QC-927H | Recombinant human C1QC protein, His/GST-tagged | +Inquiry |
C1QC-586R | Recombinant Rhesus monkey C1QC Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QC-8142HCL | Recombinant Human C1QC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C1QC Products
Required fields are marked with *
My Review for All C1QC Products
Required fields are marked with *
0
Inquiry Basket