Recombinant human C1QC protein, His/GST-tagged

Cat.No. : C1QC-927H
Product Overview : Recombinant C1QC protein(Lys117-Asp245), fused to His/GST-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 129
Description : This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis.
Form : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Molecular Mass : 44 kDa
AA Sequence : KFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD
Endotoxin : <1.0EU per 1µg (determined by the LAL method)
Purity : > 95%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name C1QC
Official Symbol C1QC
Synonyms C1QG; C1Q-C
Gene ID 714
mRNA Refseq NM_001114101.3
Protein Refseq NP_001107573.1
MIM 120575
UniProt ID P02747

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QC Products

Required fields are marked with *

My Review for All C1QC Products

Required fields are marked with *

0
cart-icon
0
compare icon