Recombinant Human C1QC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : C1QC-5655H
Product Overview : C1QC MS Standard C13 and N15-labeled recombinant protein (NP_758957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the C-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis.
Molecular Mass : 25.8 kDa
AA Sequence : MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPDSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name C1QC complement C1q C chain [ Homo sapiens (human) ]
Official Symbol C1QC
Synonyms C1QC; complement component 1, q subcomponent, C chain; C1QG, complement component 1, q subcomponent, gamma polypeptide; complement C1q subcomponent subunit C; complement component 1, q subcomponent, gamma polypeptide; C1QG; C1Q-C; FLJ27103;
Gene ID 714
mRNA Refseq NM_172369
Protein Refseq NP_758957
MIM 120575
UniProt ID P02747

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C1QC Products

Required fields are marked with *

My Review for All C1QC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon