Recombinant Human C4A protein, T7/His-tagged
Cat.No. : | C4A-98H |
Product Overview : | Recombinant human C4d domain cDNA (957 – 1336 aa), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 957-1336 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVAS LLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTW LTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHG LAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDN LYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRST QDTVIALDALSAYWIASHTTEERGLNVTLSSTGR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human C4d mediated cancer cell resistant to complement-mediated damage pathway regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. As potential diagnostic biomarker for rumors, such as lung cancer.4. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | C4A complement component 4A (Rodgers blood group) [ Homo sapiens ] |
Official Symbol | C4A |
Synonyms | C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobu |
Gene ID | 720 |
mRNA Refseq | NM_001252204 |
Protein Refseq | NP_001239133 |
MIM | 120810 |
UniProt ID | P0C0L4 |
Chromosome Location | 6p21.3 |
Pathway | Activation of C3 and C5, organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem |
Function | endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
C4A-1052R | Recombinant Rat C4A Protein | +Inquiry |
C4A-3784H | Recombinant Human C4A protein, His-tagged | +Inquiry |
C4a-567M | Recombinant Mouse C4a Protein, His/GST-tagged | +Inquiry |
C4A-10531H | Recombinant Human C4A, GST-tagged | +Inquiry |
C4A-566H | Recombinant Human C4A Protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
C4A-8392H | Native Human C4A | +Inquiry |
C4A-158H | Native Human C4A protein | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4A Products
Required fields are marked with *
My Review for All C4A Products
Required fields are marked with *