Recombinant Human C4A protein, T7/His-tagged

Cat.No. : C4A-98H
Product Overview : Recombinant human C4d domain cDNA (957 – 1336 aa), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 957-1336 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVAS LLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTW LTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHG LAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDN LYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRST QDTVIALDALSAYWIASHTTEERGLNVTLSSTGR
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro human C4d mediated cancer cell resistant to complement-mediated damage pathway regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. As potential diagnostic biomarker for rumors, such as lung cancer.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name C4A complement component 4A (Rodgers blood group) [ Homo sapiens ]
Official Symbol C4A
Synonyms C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobu
Gene ID 720
mRNA Refseq NM_001252204
Protein Refseq NP_001239133
MIM 120810
UniProt ID P0C0L4
Chromosome Location 6p21.3
Pathway Activation of C3 and C5, organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem
Function endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4A Products

Required fields are marked with *

My Review for All C4A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon