Recombinant Human C4A protein, T7/His-tagged

• Cat.No.: C4A-98H
• Product Overview: Recombinant human C4d domain cDNA (957 – 1336 aa), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 957-1336 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVAS LLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTW LTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHG LAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDN LYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRST QDTVIALDALSAYWIASHTTEERGLNVTLSSTGR
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro human C4d mediated cancer cell resistant to complement-mediated damage pathway regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for protein-protein interaction assay.3. As potential diagnostic biomarker for rumors, such as lung cancer.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: C4A complement component 4A (Rodgers blood group) [ Homo sapiens ]
• Official Symbol: C4A
• Synonyms: C4A; complement component 4A (Rodgers blood group); complement component 4A; complement C4-A; C4; C4A2; C4A3; C4A4; C4A6; C4B; C4S; CO4; CPAMD2; RG; acidic C4; C4A anaphylatoxin; Rodgers form of C4; acidic complement C4; C3 and PZP-like alpha-2-macroglobu
• Gene ID: 720
• mRNA Refseq: NM_001252204
• Protein Refseq: NP_001239133
• MIM: 120810
• UniProt ID: P0C0L4
• Chromosome Location: 6p21.3
• Pathway: Activation of C3 and C5, organism-specific biosystem; Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Complement cascade, organism-specific biosystem
• Function: endopeptidase inhibitor activity