Recombinant Human C4B
Cat.No. : | C4B-26130TH |
Product Overview : | Recombinant fragment of Human C4b with N terminal proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVE |
Sequence Similarities : | Contains 1 anaphylatoxin-like domain.Contains 1 NTR domain. |
Gene Name | C4B complement component 4B (Chido blood group) [ Homo sapiens ] |
Official Symbol | C4B |
Synonyms | C4B; complement component 4B (Chido blood group); complement component 4B; complement C4-B; C4B1; C4B3; C4F; CH; CO4; CPAMD3; |
Gene ID | 721 |
mRNA Refseq | NM_001002029 |
Protein Refseq | NP_001002029 |
MIM | 120820 |
Uniprot ID | P0C0L5 |
Chromosome Location | 6p21.3 |
Pathway | Complement Activation, Classical Pathway, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem; |
Function | endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
C4B-3818H | Recombinant Human C4B protein, His-SUMO-tagged | +Inquiry |
C4B-08H | Recombinant Human C4B protein, His-tagged | +Inquiry |
C4b-4333M | Recombinant Mouse C4b protein(1448-1738aa), His&Myc-tagged | +Inquiry |
C4B-343H | Recombinant Human C4B Protein, His-tagged | +Inquiry |
C4b-7883M | Recombinant Mouse C4b protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
C4B-1846H | Native Human C4B Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4B Products
Required fields are marked with *
My Review for All C4B Products
Required fields are marked with *