Recombinant Mouse C4b protein(1448-1738aa), His&Myc-tagged
Cat.No. : | C4b-4333M |
Product Overview : | Recombinant Mouse C4b protein(P01029)(1448-1738aa), fused with N-terminal His and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1448-1738aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETDGPHVLLYFDSVPTTRECVGFGASQEVVVGLVQPSSAVLYDYYSPDHKCSVFYAAPTKSQLLATLCSGDVCQCAEGKCPRLLRSLERRVEDKDGYRMRFACYYPRVEYGFTVKVLREDGRAAFRLFESKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIMGMDGETSDNKGDPQYLLDSNTWIEEMPSEQMCKSTRHRAACFQLKDFLMEFSSRGCQV |
Gene Name | C4b complement component 4B (Chido blood group) [ Mus musculus ] |
Official Symbol | C4b |
Synonyms | C4B; complement component 4B (Chido blood group); complement C4-B; complement component 4 (within H-2S); complement component 4B (Childo blood group); C4; Ss; |
Gene ID | 12268 |
mRNA Refseq | NM_009780 |
Protein Refseq | NP_033910 |
◆ Recombinant Proteins | ||
C4b-2921M | Recombinant Mouse C4b protein(1448-1738aa), His-tagged | +Inquiry |
C4b-7883M | Recombinant Mouse C4b protein, His & T7-tagged | +Inquiry |
C4B-341H | Recombinant Human C4B Protein, His-tagged | +Inquiry |
C4b-7884M | Recombinant Mouse C4b protein, His & T7-tagged | +Inquiry |
C4b-0053M | Recombinant Mouse C4b Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
C4B-10H | Native Human C4B Protein | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4b Products
Required fields are marked with *
My Review for All C4b Products
Required fields are marked with *