Recombinant Human CA1 protein, His-SUMO-tagged
| Cat.No. : | CA1-2614H |
| Product Overview : | Recombinant Human CA1 protein(P00915)(2-261aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-261aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.7 kDa |
| AA Sequence : | ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CA1 carbonic anhydrase I [ Homo sapiens ] |
| Official Symbol | CA1 |
| Synonyms | CA1; carbonic anhydrase I; carbonic anhydrase 1; Car1; carbonic anhydrase B; carbonic dehydratase; carbonate dehydratase I; CAB; CA-I; |
| Gene ID | 759 |
| mRNA Refseq | NM_001128829 |
| Protein Refseq | NP_001122301 |
| MIM | 114800 |
| UniProt ID | P00915 |
| ◆ Recombinant Proteins | ||
| CAR1-1131R | Recombinant Rat CAR1 Protein | +Inquiry |
| CA1-1151M | Recombinant Mouse CA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CA1-1347R | Recombinant Rat CA1 Protein (2-261 aa), His-tagged | +Inquiry |
| CA1-10612H | Recombinant Human CA1, GST-tagged | +Inquiry |
| CA1-2503H | Recombinant Human CA1 protein(11-260 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CA1-7917HCL | Recombinant Human CA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA1 Products
Required fields are marked with *
My Review for All CA1 Products
Required fields are marked with *
