"CA10" Related Products

Expand
Expand
Expand

Recombinant Human CA10 Protein, GST-Tagged

Cat.No. : CA10-0229H
Product Overview : Human CA10 partial ORF (NP_064563.1, 229 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : TSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CA10 carbonic anhydrase X [ Homo sapiens ]
Official Symbol : CA10
Synonyms : CA10; carbonic anhydrase X; carbonic anhydrase-related protein 10; CA RPX; CARPX; HUCEP 15; CARP X; CA-RP X; cerebral protein 15; cerebral protein-15; carbonic anhydrase-related protein X; CA-RPX; HUCEP-15;
Gene ID : 56934
mRNA Refseq : NM_001082533
Protein Refseq : NP_001076002
MIM : 604642
UniProt ID : Q9NS85

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.