Recombinant Human CABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CABP2-3524H
Product Overview : CABP2 MS Standard C13 and N15-labeled recombinant protein (NP_057450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene belongs to a subfamily of calcium binding proteins that share similarity to calmodulin. Like calmodulin, these family members can likely stimulate calmodulin-dependent kinase II and the protein phosphatase calcineurin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 24.3 kDa
AA Sequence : MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CABP2 calcium binding protein 2 [ Homo sapiens (human) ]
Official Symbol CABP2
Synonyms CABP2; calcium binding protein 2; DFNB93; calcium-binding protein 2
Gene ID 51475
mRNA Refseq NM_016366
Protein Refseq NP_057450
MIM 607314
UniProt ID Q9NPB3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CABP2 Products

Required fields are marked with *

My Review for All CABP2 Products

Required fields are marked with *

0
cart-icon