Recombinant Human CABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CABP2-3524H |
Product Overview : | CABP2 MS Standard C13 and N15-labeled recombinant protein (NP_057450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene belongs to a subfamily of calcium binding proteins that share similarity to calmodulin. Like calmodulin, these family members can likely stimulate calmodulin-dependent kinase II and the protein phosphatase calcineurin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 24.3 kDa |
AA Sequence : | MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CABP2 calcium binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | CABP2 |
Synonyms | CABP2; calcium binding protein 2; DFNB93; calcium-binding protein 2 |
Gene ID | 51475 |
mRNA Refseq | NM_016366 |
Protein Refseq | NP_057450 |
MIM | 607314 |
UniProt ID | Q9NPB3 |
◆ Recombinant Proteins | ||
CABP2-3924HFL | Recombinant Full Length Human CABP2 protein, Flag-tagged | +Inquiry |
CABP2-3524H | Recombinant Human CABP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cabp2-1923M | Recombinant Mouse Cabp2 Protein, Myc/DDK-tagged | +Inquiry |
Cabp2-1117M | Recombinant Mouse Cabp2 protein, His & T7-tagged | +Inquiry |
CABP2-4990C | Recombinant Chicken CABP2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CABP2 Products
Required fields are marked with *
My Review for All CABP2 Products
Required fields are marked with *
0
Inquiry Basket