Recombinant Human CABYR Protein, GST-Tagged
| Cat.No. : | CABYR-0262H |
| Product Overview : | Human CABYR full-length ORF (NP_619585.1, 1 a.a. - 379 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. [provided by RefSeq, Jul 2013] |
| Molecular Mass : | 67.5 kDa |
| AA Sequence : | MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CABYR calcium binding tyrosine phosphorylation regulated [ Homo sapiens (human) ] |
| Official Symbol | CABYR |
| Synonyms | CABYR; calcium binding tyrosine phosphorylation regulated; CT88; FSP2; CBP86; FSP-2; CABYRa; CABYRc; CABYRe; CABYRc/d; calcium-binding tyrosine phosphorylation-regulated protein; calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2); calcium-binding protein 86; cancer/testis antigen 88; fibrousheathin II; fibrousheathin-2; testis tissue sperm-binding protein Li 84P; testis-specific calcium-binding protein CBP86; Calcium Binding Tyrosine Phosphorylation Regulated; Cancer/Testis Antigen 88; Testis-Specific Calcium-Binding Protein CBP86; Calcium-Binding Protein 86; Fibrousheathin II; Fibrousheathin-2; Calcium Binding Tyrosine-(Y)-Phosphorylation Regulated (Fibrousheathin 2); Calcium-Binding Tyrosine Phosphorylation-Regulated Protein; Calcium Binding Tyrosine-(Y)-Phosphorylation Regulated; Testis Tissue Sperm-Binding Protein Li 84P; Fibrousheathin 2 |
| Gene ID | 26256 |
| mRNA Refseq | NM_001308231 |
| Protein Refseq | NP_001295160 |
| MIM | 612135 |
| UniProt ID | O75952 |
| ◆ Recombinant Proteins | ||
| CABYR-102C | Recombinant Cynomolgus Monkey CABYR Protein, His (Fc)-Avi-tagged | +Inquiry |
| CABYR-482H | Recombinant Human CABYR Protein, His (Fc)-Avi-tagged | +Inquiry |
| CABYR-354C | Recombinant Cynomolgus CABYR Protein, His-tagged | +Inquiry |
| CABYR-2804HF | Recombinant Full Length Human CABYR Protein, GST-tagged | +Inquiry |
| Cabyr-1927M | Recombinant Mouse Cabyr Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CABYR-7906HCL | Recombinant Human CABYR 293 Cell Lysate | +Inquiry |
| CABYR-7905HCL | Recombinant Human CABYR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CABYR Products
Required fields are marked with *
My Review for All CABYR Products
Required fields are marked with *
