Recombinant Human CACNA2D1 protein, GST-tagged
Cat.No. : | CACNA2D1-3729H |
Product Overview : | Recombinant Human CACNA2D1 protein(25-124 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-124 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ] |
Official Symbol | CACNA2D1 |
Synonyms | CACNA2D1; calcium channel, voltage-dependent, alpha 2/delta subunit 1; CACNA2, CACNL2A, MHS3; voltage-dependent calcium channel subunit alpha-2/delta-1; calcium channel, L type, alpha 2 polypeptide; voltage-gated calcium channel subunit alpha-2/delta-1; dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit; CACNA2; CCHL2A; CACNL2A; |
Gene ID | 781 |
mRNA Refseq | NM_000722 |
Protein Refseq | NP_000713 |
MIM | 114204 |
UniProt ID | P54289 |
◆ Recombinant Proteins | ||
CACNA2D1-1170M | Recombinant Mouse CACNA2D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNA2D1-2619H | Recombinant Human CACNA2D1 protein, His-SUMO-tagged | +Inquiry |
CACNA2D1-3729H | Recombinant Human CACNA2D1 protein, GST-tagged | +Inquiry |
CACNA2D1-089H | Recombinant Human CACNA2D1 protein, His-SUMO-tagged | +Inquiry |
CACNA2D1-2301H | Recombinant Human CACNA2D1 Protein (577-717 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA2D1 Products
Required fields are marked with *
My Review for All CACNA2D1 Products
Required fields are marked with *