Recombinant Human CACNA2D1 Protein (577-717 aa), His-tagged
Cat.No. : | CACNA2D1-2301H |
Product Overview : | Recombinant Human CACNA2D1 Protein (577-717 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 577-717 aa |
Description : | The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.3 kDa |
AA Sequence : | KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ] |
Official Symbol | CACNA2D1 |
Synonyms | CACNA2D1; CACNA2; CCHL2A; CACNL2A; |
Gene ID | 781 |
mRNA Refseq | NM_000722 |
Protein Refseq | NP_000713 |
MIM | 114204 |
UniProt ID | P54289 |
◆ Recombinant Proteins | ||
CACNA2D1-3729H | Recombinant Human CACNA2D1 protein, GST-tagged | +Inquiry |
CACNA2D1-4079C | Recombinant Chicken CACNA2D1 | +Inquiry |
CACNA2D1-2301H | Recombinant Human CACNA2D1 Protein (577-717 aa), His-tagged | +Inquiry |
CACNA2D1-2391H | Recombinant Human CACNA2D1 Protein (528-668 aa), His-SUMO-tagged | +Inquiry |
CACNA2D1-2615M | Recombinant Mouse CACNA2D1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA2D1 Products
Required fields are marked with *
My Review for All CACNA2D1 Products
Required fields are marked with *