Recombinant Human CACNA2D1 Protein (577-717 aa), His-tagged

Cat.No. : CACNA2D1-2301H
Product Overview : Recombinant Human CACNA2D1 Protein (577-717 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 577-717 aa
Description : The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 18.3 kDa
AA Sequence : KMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ]
Official Symbol CACNA2D1
Synonyms CACNA2D1; CACNA2; CCHL2A; CACNL2A;
Gene ID 781
mRNA Refseq NM_000722
Protein Refseq NP_000713
MIM 114204
UniProt ID P54289

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CACNA2D1 Products

Required fields are marked with *

My Review for All CACNA2D1 Products

Required fields are marked with *

0
cart-icon
0
compare icon