Recombinant Human CACNA2D1 protein, His-SUMO-tagged
Cat.No. : | CACNA2D1-089H |
Product Overview : | Recombinant Human CACNA2D1 protein(P54289)(528-668aa), fused to N-terminal His and SUMO tags, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 528-668aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.3 kDa |
AA Sequence : | QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ] |
Official Symbol | CACNA2D1 |
Synonyms | CACNA2D1; calcium channel, voltage-dependent, alpha 2/delta subunit 1; CACNA2, CACNL2A, MHS3; voltage-dependent calcium channel subunit alpha-2/delta-1; calcium channel, L type, alpha 2 polypeptide; voltage-gated calcium channel subunit alpha-2/delta-1; dihydropyridine-sensitive L-type, calcium channel alpha-2/delta subunit; CACNA2; CCHL2A; CACNL2A; |
Gene ID | 781 |
mRNA Refseq | NM_000722 |
Protein Refseq | NP_000713 |
MIM | 114204 |
UniProt ID | P54289 |
◆ Recombinant Proteins | ||
CACNA2D1-29H | Recombinant Human CACNA2D1 protein, Trx-His-SUMO-tagged | +Inquiry |
CACNA2D1-2301H | Recombinant Human CACNA2D1 Protein (577-717 aa), His-tagged | +Inquiry |
CACNA2D1-089H | Recombinant Human CACNA2D1 protein, His-SUMO-tagged | +Inquiry |
CACNA2D1-4079C | Recombinant Chicken CACNA2D1 | +Inquiry |
CACNA2D1-2579H | Recombinant Human CACNA2D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA2D1 Products
Required fields are marked with *
My Review for All CACNA2D1 Products
Required fields are marked with *