Recombinant Human CACNA2D1 Protein (528-668 aa), His-SUMO-tagged
| Cat.No. : | CACNA2D1-2391H |
| Product Overview : | Recombinant Human CACNA2D1 Protein (528-668 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 528-668 aa |
| Description : | The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Plays an important role in excitation-contraction coupling. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 32.3 kDa |
| AA Sequence : | QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | CACNA2D1 calcium channel, voltage-dependent, alpha 2/delta subunit 1 [ Homo sapiens ] |
| Official Symbol | CACNA2D1 |
| Synonyms | CACNA2D1; CACNA2, CACNL2A, MHS3; CACNA2; CCHL2A; CACNL2A; |
| Gene ID | 781 |
| mRNA Refseq | NM_000722 |
| Protein Refseq | NP_000713 |
| MIM | 114204 |
| UniProt ID | P54289 |
| ◆ Recombinant Proteins | ||
| CACNA2D1-2615M | Recombinant Mouse CACNA2D1 Protein | +Inquiry |
| CACNA2D1-2619H | Recombinant Human CACNA2D1 protein, His-SUMO-tagged | +Inquiry |
| CACNA2D1-29H | Recombinant Human CACNA2D1 protein, Trx-His-SUMO-tagged | +Inquiry |
| CACNA2D1-4079C | Recombinant Chicken CACNA2D1 | +Inquiry |
| CACNA2D1-089H | Recombinant Human CACNA2D1 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACNA2D1 Products
Required fields are marked with *
My Review for All CACNA2D1 Products
Required fields are marked with *
