Recombinant Human CALB1 protein, His-tagged
Cat.No. : | CALB1-3342H |
Product Overview : | Recombinant Human CALB1 protein(P05937)(2-261aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-261aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN |
Gene Name | CALB1 calbindin 1, 28kDa [ Homo sapiens ] |
Official Symbol | CALB1 |
Synonyms | CALB1; calbindin 1, 28kDa; CALB; calbindin; D-28K; calbindin D28; RTVL-H protein; calbindin 1, (28kD); vitamin D-dependent calcium-binding protein, avian-type; |
Gene ID | 793 |
mRNA Refseq | NM_004929 |
Protein Refseq | NP_004920 |
MIM | 114050 |
UniProt ID | P05937 |
◆ Recombinant Proteins | ||
Calb1-251R | Recombinant Rat Calbindin 1 | +Inquiry |
CALB1-1085R | Recombinant Rat CALB1 Protein | +Inquiry |
CALB1-749R | Recombinant Rat CALB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Calb1-743M | Recombinant Mouse Calb1 Protein, MYC/DDK-tagged | +Inquiry |
CALB1-1393H | Recombinant Human Calbindin 1, 28kDa | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALB1-7897HCL | Recombinant Human CALB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALB1 Products
Required fields are marked with *
My Review for All CALB1 Products
Required fields are marked with *
0
Inquiry Basket