Recombinant Human CALML5 protein, His-tagged
Cat.No. : | CALML5-3241H |
Product Overview : | Recombinant Human CALML5 protein(1-120 aa), fused to His tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-120 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTAARKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CALML5 calmodulin-like 5 [ Homo sapiens ] |
Official Symbol | CALML5 |
Synonyms | CALML5; calmodulin-like 5; calmodulin-like protein 5; calmodulin like skin protein; CLSP; calmodulin-like skin protein; |
Gene ID | 51806 |
mRNA Refseq | NM_017422 |
Protein Refseq | NP_059118 |
MIM | 605183 |
UniProt ID | Q9NZT1 |
◆ Recombinant Proteins | ||
CALML5-7436H | Recombinant Human CALML5 protein, GST-tagged | +Inquiry |
CALML5-3928H | Recombinant Human CALML5 protein(Met1-Glu146), His&GST-tagged | +Inquiry |
CALML5-3241H | Recombinant Human CALML5 protein, His-tagged | +Inquiry |
CALML5-609R | Recombinant Rhesus monkey CALML5 Protein, His-tagged | +Inquiry |
CALML5-437R | Recombinant Rhesus Macaque CALML5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALML5-7886HCL | Recombinant Human CALML5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALML5 Products
Required fields are marked with *
My Review for All CALML5 Products
Required fields are marked with *