Recombinant Human CALR3 protein
Cat.No. : | CALR3-271H |
Product Overview : | Recombinant Human CALR3(Thr20-Leu384) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | Thr20-Leu384 |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
AA Sequence : | MTVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKP FSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVIL HFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAE SKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHR KMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREM DAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | CALR3 calreticulin 3 [ Homo sapiens ] |
Official Symbol | CALR3 |
Synonyms | CALR3; calreticulin 3; calreticulin-3; calsperin; cancer/testis antigen 93; CRT2; CT93; FLJ25355; MGC26577; calreticulin-2; CMH19; |
Gene ID | 125972 |
mRNA Refseq | NM_145046 |
Protein Refseq | NP_659483 |
MIM | 611414 |
UniProt ID | Q96L12 |
Chromosome Location | 19p13.11 |
Function | calcium ion binding; sugar binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
Calr3-1941M | Recombinant Mouse Calr3 Protein, Myc/DDK-tagged | +Inquiry |
CALR3-271H | Recombinant Human CALR3 protein | +Inquiry |
CALR3-3079HF | Recombinant Full Length Human CALR3 Protein, GST-tagged | +Inquiry |
CALR3-476H | Recombinant Human calreticulin 3, His-tagged | +Inquiry |
CALR3-5077H | Recombinant Human CALR3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR3-7884HCL | Recombinant Human CALR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALR3 Products
Required fields are marked with *
My Review for All CALR3 Products
Required fields are marked with *