Recombinant Human CALR3 protein

• Cat.No.: CALR3-271H
• Product Overview: Recombinant Human CALR3(Thr20-Leu384) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: Thr20-Leu384
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.
• AA Sequence: MTVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKP FSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVIL HFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAE SKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHR KMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREM DAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: CALR3 calreticulin 3 [ Homo sapiens ]
• Official Symbol: CALR3
• Synonyms: CALR3; calreticulin 3; calreticulin-3; calsperin; cancer/testis antigen 93; CRT2; CT93; FLJ25355; MGC26577; calreticulin-2; CMH19
• Gene ID: 125972
• mRNA Refseq: NM_145046
• Protein Refseq: NP_659483
• MIM: 611414
• UniProt ID: Q96L12
• Chromosome Location: 19p13.11
• Function: calcium ion binding; sugar binding; unfolded protein binding