Recombinant Human CALR3 protein

Cat.No. : CALR3-271H
Product Overview : Recombinant Human CALR3(Thr20-Leu384) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : Thr20-Leu384
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.
AA Sequence : MTVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKP FSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVIL HFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAE SKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHR KMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREM DAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name CALR3 calreticulin 3 [ Homo sapiens ]
Official Symbol CALR3
Synonyms CALR3; calreticulin 3; calreticulin-3; calsperin; cancer/testis antigen 93; CRT2; CT93; FLJ25355; MGC26577; calreticulin-2; CMH19;
Gene ID 125972
mRNA Refseq NM_145046
Protein Refseq NP_659483
MIM 611414
UniProt ID Q96L12
Chromosome Location 19p13.11
Function calcium ion binding; sugar binding; unfolded protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALR3 Products

Required fields are marked with *

My Review for All CALR3 Products

Required fields are marked with *

0
cart-icon