Recombinant Human CAPN1, His-tagged
Cat.No. : | CAPN1-27399TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 214-500 of Human Calpain 1 with N terminal His tag; 287 amino acids, 33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 214-500 a.a. |
Description : | The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 121 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSID ISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSL IRMRNPWGEVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKSRTIRKWNTT LYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDP DDYGDRESGCSFVLALMQKHRRRERRFGRDMETIGFAVYE VPPELVGQPAVHLKRDFFLANASRARSEQFINLREVST RFRLPPGEYVVVPST |
Sequence Similarities : | Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 4 EF-hand domains. |
Gene Name | CAPN1 calpain 1, (mu/I) large subunit [ Homo sapiens ] |
Official Symbol | CAPN1 |
Synonyms | CAPN1; calpain 1, (mu/I) large subunit; calpain-1 catalytic subunit; CANP; CANPL1; muCANP; muCL; |
Gene ID | 823 |
mRNA Refseq | NM_001198868 |
Protein Refseq | NP_001185797 |
MIM | 114220 |
Uniprot ID | P07384 |
Chromosome Location | 11q13 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; |
Function | calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; peptidase activity; |
◆ Recombinant Proteins | ||
CAPN1-3464C | Recombinant Chicken CAPN1 | +Inquiry |
CAPN1-1118R | Recombinant Rat CAPN1 Protein | +Inquiry |
CAPN1-782R | Recombinant Rat CAPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Capn1-2630M | Recombinant Mouse Capn1 protein, His-tagged | +Inquiry |
Capn1-2030M | Recombinant Mouse Capn1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CAPN1-8448H | Active Native Human CAPN1 | +Inquiry |
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN1-7865HCL | Recombinant Human CAPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAPN1 Products
Required fields are marked with *
My Review for All CAPN1 Products
Required fields are marked with *