| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-261aa |
| Description : |
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. |
| Form : |
Liquid |
| Molecular Mass : |
31.0 kDa |
| Bio-activity : |
Specific activity is > 300 pmol/min/μg, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of 4-nitrophenyl acetate to 4-nitrophenol per minute at pH 8.0 at 37 centigrade. |
| AASequence : |
MGSSHHHHHHSSGLVPRGSHMASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Application : |
SDS-PAGE, Enzyme Activity |
| Purity : |
> 95% by SDS-PAGE |
| Note : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
| Reference : |
1. Nogradi A., et al. (1998). Am J Pathol. 153:1-4.
2. Ferry JG., et al. (1999). Proc Natl Acad Sci U S A. 96(26):15184-9 |
