Recombinant Human CARD16 Protein, GST-tagged

Cat.No. : CARD16-1690H
Product Overview : Human COP1 full-length ORF ( NP_443121.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CARD16 (Caspase Recruitment Domain Family Member 16) is a Protein Coding gene. Among its related pathways are Toll-Like receptor Signaling Pathways. GO annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CARD17.
Molecular Mass : 37.1 kDa
AA Sequence : MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CARD16 caspase recruitment domain family, member 16 [ Homo sapiens ]
Official Symbol CARD16
Synonyms CARD16; caspase recruitment domain family, member 16; caspase recruitment domain-containing protein 16; COP; COP1; PSEUDO ICE; CARD only protein; caspase-1 inhibitor COP; CARD only domain-containing protein 1; pseudo interleukin-1beta converting enzyme; pseudo interleukin-1 beta converting enzyme; caspase-1 dominant-negative inhibitor pseudo-ICE; PSEUDO-ICE;
Gene ID 114769
mRNA Refseq NM_001017534
Protein Refseq NP_001017534
MIM 615680
UniProt ID Q5EG05

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CARD16 Products

Required fields are marked with *

My Review for All CARD16 Products

Required fields are marked with *

0
cart-icon