Recombinant Human CATSPERZ Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CATSPERZ-6346H
• Product Overview: C11orf20 MS Standard C13 and N15-labeled recombinant protein (NP_001034585) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CATSPERZ (Catsper Channel Auxiliary Subunit Zeta) is a Protein Coding gene. Diseases associated with CATSPERZ include Hidradenoma.
• Molecular Mass: 22.7 kDa
• AA Sequence: MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CATSPERZ catsper channel auxiliary subunit zeta [ Homo sapiens (human) ]
• Official Symbol: CATSPERZ
• Synonyms: CATSPERZ; catsper channel auxiliary subunit zeta; TEX40; C11orf20; cation channel sperm-associated protein subunit zeta; catSper-zeta; catSperzeta; testis expressed 40; testis-expressed protein 40; testis-expressed sequence 40 protein
• Gene ID: 25858
• mRNA Refseq: NM_001039496
• Protein Refseq: NP_001034585
• MIM: 617511
• UniProt ID: Q9NTU4