Recombinant Human CBR1 protein, GST-tagged
Cat.No. : | CBR1-2642H |
Product Overview : | Recombinant Human CBR1 protein(P16152)(2-277aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-277aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.2 kDa |
AA Sequence : | SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CBR1 carbonyl reductase 1 [ Homo sapiens ] |
Official Symbol | CBR1 |
Synonyms | CBR1; carbonyl reductase 1; CBR; carbonyl reductase [NADPH] 1; SDR21C1; short chain dehydrogenase/reductase family 21C; member 1; carbonyl reductase (NADPH) 1; prostaglandin 9-ketoreductase; prostaglandin-E(2) 9-reductase; NADPH-dependent carbonyl reductase 1; 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 21C, member 1; hCBR1; |
Gene ID | 873 |
mRNA Refseq | NM_001757 |
Protein Refseq | NP_001748 |
MIM | 114830 |
UniProt ID | P16152 |
◆ Cell & Tissue Lysates | ||
CBR1-288HCL | Recombinant Human CBR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBR1 Products
Required fields are marked with *
My Review for All CBR1 Products
Required fields are marked with *
0
Inquiry Basket