Recombinant Human CBS, His-tagged
Cat.No. : | CBS-27861TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 242-551 of Human CBS with N terminal His tag; MWt 38kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 242-551 a.a. |
Description : | The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. Multiple alternatively spliced transcript variants have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney. |
Form : | Lyophilised:Reconstitute with 153 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVD PEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTV VDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVA VKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKG FLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTI EILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKV QPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALV VHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERD QK |
Sequence Similarities : | Belongs to the cysteine synthase/cystathionine beta-synthase family.Contains 1 CBS domain. |
Gene Name | CBS cystathionine-beta-synthase [ Homo sapiens ] |
Official Symbol | CBS |
Synonyms | CBS; cystathionine-beta-synthase; cystathionine beta-synthase; HIP4; |
Gene ID | 875 |
mRNA Refseq | NM_000071 |
Protein Refseq | NP_000062 |
MIM | 613381 |
Uniprot ID | P35520 |
Chromosome Location | 21q22.3 |
Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Cysteine biosynthesis, homocysteine + serine => cysteine, organism-specific biosystem; Cysteine biosynthesis, homocysteine + serine => |
Function | cystathionine beta-synthase activity; enzyme binding; heme binding; heme binding; lyase activity; |
◆ Recombinant Proteins | ||
CBS-819R | Recombinant Rat CBS Protein, His (Fc)-Avi-tagged | +Inquiry |
Cbs-827M | Recombinant Mouse Cbs Protein, MYC/DDK-tagged | +Inquiry |
CBS-0471H | Recombinant Human CBS Protein, GST-Tagged | +Inquiry |
CBS-363C | Recombinant Cynomolgus CBS Protein, His-tagged | +Inquiry |
CBS-10765H | Recombinant Human CBS, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBS Products
Required fields are marked with *
My Review for All CBS Products
Required fields are marked with *
0
Inquiry Basket