Recombinant Human CBS, His-tagged
| Cat.No. : | CBS-27861TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 242-551 of Human CBS with N terminal His tag; MWt 38kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 242-551 a.a. |
| Description : | The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. Multiple alternatively spliced transcript variants have been found for this gene. |
| Conjugation : | HIS |
| Tissue specificity : | In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney. |
| Form : | Lyophilised:Reconstitute with 153 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVD PEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTV VDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVA VKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKG FLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTI EILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKV QPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALV VHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERD QK |
| Sequence Similarities : | Belongs to the cysteine synthase/cystathionine beta-synthase family.Contains 1 CBS domain. |
| Gene Name | CBS cystathionine-beta-synthase [ Homo sapiens ] |
| Official Symbol | CBS |
| Synonyms | CBS; cystathionine-beta-synthase; cystathionine beta-synthase; HIP4; |
| Gene ID | 875 |
| mRNA Refseq | NM_000071 |
| Protein Refseq | NP_000062 |
| MIM | 613381 |
| Uniprot ID | P35520 |
| Chromosome Location | 21q22.3 |
| Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Cysteine biosynthesis, homocysteine + serine => cysteine, organism-specific biosystem; Cysteine biosynthesis, homocysteine + serine => |
| Function | cystathionine beta-synthase activity; enzyme binding; heme binding; heme binding; lyase activity; |
| ◆ Recombinant Proteins | ||
| CBS-5626H | Recombinant Human CBS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CBS-2643H | Recombinant Human CBS protein, His-tagged | +Inquiry |
| CBS-1191HFL | Recombinant Full Length Human CBS Protein, C-Flag-tagged | +Inquiry |
| CBS-1960M | Recombinant Mouse CBS Protein (2-561 aa), His-tagged | +Inquiry |
| CBS-1918M | Recombinant Mouse CBS Protein (2-561 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CBS-331HKCL | Human CBS Knockdown Cell Lysate | +Inquiry |
| CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBS Products
Required fields are marked with *
My Review for All CBS Products
Required fields are marked with *
