Recombinant Human CBX3 protein, GST-tagged
| Cat.No. : | CBX3-10769H |
| Product Overview : | Recombinant Human CBX3 protein(1-183 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-183 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | CBX3 chromobox homolog 3 [ Homo sapiens ] |
| Official Symbol | CBX3 |
| Synonyms | CBX3; chromobox homolog 3; chromobox homolog 3 (Drosophila HP1 gamma); chromobox protein homolog 3; HP1 gamma homolog (Drosophila); HP1Hs gamma; HP1 gamma homolog; modifier 2 protein; heterochromatin-like protein 1; heterochromatin protein HP1 gamma; heterochromatin protein 1 homolog gamma; chromobox homolog 3 (HP1 gamma homolog, Drosophila); HECH; HP1-GAMMA; HP1Hs-gamma; |
| Gene ID | 11335 |
| mRNA Refseq | NM_007276 |
| Protein Refseq | NP_009207 |
| MIM | 604477 |
| UniProt ID | Q13185 |
| ◆ Recombinant Proteins | ||
| CBX3-623HF | Recombinant Full Length Human CBX3 Protein, GST-tagged | +Inquiry |
| CBX3-3561HFL | Recombinant Full Length Human CBX3 protein, Flag-tagged | +Inquiry |
| CBX3-9651H | Recombinant Human CBX3 protein, His-tagged | +Inquiry |
| CBX3-269H | Recombinant Human CBX3 protein, His-tagged | +Inquiry |
| CBX3-6522H | Recombinant Human CBX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CBX3-7805HCL | Recombinant Human CBX3 293 Cell Lysate | +Inquiry |
| CBX3-7804HCL | Recombinant Human CBX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBX3 Products
Required fields are marked with *
My Review for All CBX3 Products
Required fields are marked with *
