Recombinant Human CBX3 protein, GST-tagged

• Cat.No.: CBX3-10769H
• Product Overview: Recombinant Human CBX3 protein(1-183 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-183 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: CBX3 chromobox homolog 3 [ Homo sapiens ]
• Official Symbol: CBX3
• Synonyms: CBX3; chromobox homolog 3; chromobox homolog 3 (Drosophila HP1 gamma); chromobox protein homolog 3; HP1 gamma homolog (Drosophila); HP1Hs gamma; HP1 gamma homolog; modifier 2 protein; heterochromatin-like protein 1; heterochromatin protein HP1 gamma; heterochromatin protein 1 homolog gamma; chromobox homolog 3 (HP1 gamma homolog, Drosophila); HECH; HP1-GAMMA; HP1Hs-gamma
• Gene ID: 11335
• mRNA Refseq: NM_007276
• Protein Refseq: NP_009207
• MIM: 604477
• UniProt ID: Q13185