Recombinant Human CBX3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CBX3-6522H
Product Overview : CBX3 MS Standard C13 and N15-labeled recombinant protein (NP_057671) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.
Molecular Mass : 20.8 kDa
AA Sequence : MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CBX3 chromobox homolog 3 [ Homo sapiens (human) ]
Official Symbol CBX3
Synonyms CBX3; chromobox homolog 3; chromobox homolog 3 (Drosophila HP1 gamma); chromobox protein homolog 3; HP1 gamma homolog (Drosophila); HP1Hs gamma; HP1 gamma homolog; modifier 2 protein; heterochromatin-like protein 1; heterochromatin protein HP1 gamma; heterochromatin protein 1 homolog gamma; chromobox homolog 3 (HP1 gamma homolog, Drosophila); HECH; HP1-GAMMA; HP1Hs-gamma;
Gene ID 11335
mRNA Refseq NM_016587
Protein Refseq NP_057671
MIM 604477
UniProt ID Q13185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CBX3 Products

Required fields are marked with *

My Review for All CBX3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon