Recombinant Human CBX5 Protein, GST-Tagged
Cat.No. : | CBX5-0483H |
Product Overview : | Human CBX5 full-length ORF (AAH06821, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family. The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The encoded product is involved in the formation of functional kinetochore through interaction with essential kinetochore proteins. The gene has a pseudogene located on chromosome 3. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 46.75 kDa |
AA Sequence : | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CBX5 chromobox homolog 5 [ Homo sapiens ] |
Official Symbol | CBX5 |
Synonyms | CBX5; chromobox homolog 5; chromobox homolog 5 (Drosophila HP1 alpha), chromobox homolog 5 (HP1 alpha homolog, Drosophila); chromobox protein homolog 5; HP1; HP1 alpha homolog (Drosophila); HP1 ALPHA; HP1Hs alpha; HP1-ALPHA; antigen p25; HP1 alpha homolog; heterochromatin protein 1-alpha; heterochromatin protein 1 homolog alpha; chromobox homolog 5 (HP1 alpha homolog, Drosophila); HP1A; |
Gene ID | 23468 |
mRNA Refseq | NM_001127321 |
Protein Refseq | NP_001120793 |
MIM | 604478 |
UniProt ID | P45973 |
◆ Recombinant Proteins | ||
CBX5-1272M | Recombinant Mouse CBX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CBX5-3435H | Recombinant Human CBX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CBX5-1112H | Recombinant Human CBX5 protein, His&Myc-tagged | +Inquiry |
CBX5-2781HF | Recombinant Full Length Human CBX5 Protein, GST-tagged | +Inquiry |
CBX5-1781H | Recombinant Human CBX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBX5-7802HCL | Recombinant Human CBX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CBX5 Products
Required fields are marked with *
My Review for All CBX5 Products
Required fields are marked with *