Recombinant Human CCL1 protein(24-96aa), MBP&His-Avi-tagged, Biotinylated
Cat.No. : | CCL1-1168H |
Product Overview : | Biotinylated Recombinant Human CCL1 protein(P22362)(24-96aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&His&MBP |
Protein Length : | 24-96aa |
Conjugation/Label : | Biotin |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Conjugation : | Biotin |
Gene Name | CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ] |
Official Symbol | CCL1 |
Synonyms | CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1; |
Gene ID | 6346 |
mRNA Refseq | NM_002981 |
Protein Refseq | NP_002972 |
MIM | 182281 |
UniProt ID | P22362 |
◆ Recombinant Proteins | ||
CCL1-1532H | Recombinant Human CCL1 protein, His & GST-tagged | +Inquiry |
Ccl1-2027M | Active Recombinant Mouse Ccl1 Protein | +Inquiry |
CCL1-506R | Recombinant Rhesus Macaque CCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL1-69H | Recombinant Human CCL1 Protein | +Inquiry |
CCL1-6340C | Recombinant Chicken CCL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL1-3060HCL | Recombinant Human CCL1 cell lysate | +Inquiry |
CCL1-1690MCL | Recombinant Mouse CCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL1 Products
Required fields are marked with *
My Review for All CCL1 Products
Required fields are marked with *