Recombinant Human CCL17 protein

Cat.No. : CCL17-24H
Product Overview : Recombinant Human CCL17 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 71
Description : Human CCL17 also known as thymus and activation-related chemokine (TARC) is encoded by the CCL17 gene located on the chromosome 16 in humans. It is expressed by thymus cells constitutively and phytohemagglutinin-stimulated peripheral blood mononuclear cells transiently. CCL17 signals through the chemokine receptors CCR4 and CCR8 and displays chemotactic activity for T lymphocytes and some other leukocytes. It plays an important role in skin diseases such as atopic dermatitis, bullous pemphigoid and mycosis fungoides. CCL17 has approximately 24 – 29 % amino acid sequence identity with RANTES, MIP-1α, MIP-1β, MCP-1, MCP-2, MCP-3 and I-309.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.
Molecular Mass : Approximately 8.1 kDa, a single non-glycosylated polypeptide chain containing 71 amino acids.
AA Sequence : ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Endotoxin : Less than 1 EU/μg of rHuTARC/CCL17 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL17
Official Symbol CCL17
Synonyms CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; ABCD-2; SCYA17; A-152E5.3; MGC138271; MGC138273;
Gene ID 6361
mRNA Refseq NM_002987
Protein Refseq NP_002978
MIM 601520
UniProt ID Q92583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL17 Products

Required fields are marked with *

My Review for All CCL17 Products

Required fields are marked with *

0
cart-icon
0
compare icon