Recombinant Human CCL21 protein

Cat.No. : CCL21-2886H
Product Overview : Recombinant Human CCL21 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 111
Description : CCL21 is encoded by CCL21 gene that is located in Chr. 9 and shows 21-33 % identity to other CC chemokines. This chemokine contains the four conserved cysteines characteristic of β chemokines plus two additional cysteines in its unusually long carboxylterminal domain. CCL21 is highly expressed in lymph nodes of certain endothelial cells, and in the spleen and appendix. It elicits effects by binding with CCR7, having functions of T and B lymphocytes chemotaxis and inhibiting hematopoiesis.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 12.2 kDa, a single, non-glycosylated polypeptide chain containing 111 amino acids.
AA Sequence : SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Endotoxin : Less than 1 EU/μg of rHuExodus-2/CCL21 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL21
Official Symbol CCL21
Synonyms CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555;
Gene ID 6366
mRNA Refseq NM_002989
Protein Refseq NP_002980
MIM 602737
UniProt ID O00585

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL21 Products

Required fields are marked with *

My Review for All CCL21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon