Recombinant Human CCL21 protein, GST-tagged

Cat.No. : CCL21-2653H
Product Overview : Recombinant Human CCL21 protein(O00585)(24-134aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-134aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 39.3 kDa
AA Sequence : SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CCL21 chemokine (C-C motif) ligand 21 [ Homo sapiens ]
Official Symbol CCL21
Synonyms CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555;
Gene ID 6366
mRNA Refseq NM_002989
Protein Refseq NP_002980
MIM 602737
UniProt ID O00585

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL21 Products

Required fields are marked with *

My Review for All CCL21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon