Recombinant Human CCL21 protein, GST-tagged
| Cat.No. : | CCL21-2653H |
| Product Overview : | Recombinant Human CCL21 protein(O00585)(24-134aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-134aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.3 kDa |
| AA Sequence : | SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CCL21 chemokine (C-C motif) ligand 21 [ Homo sapiens ] |
| Official Symbol | CCL21 |
| Synonyms | CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555; |
| Gene ID | 6366 |
| mRNA Refseq | NM_002989 |
| Protein Refseq | NP_002980 |
| MIM | 602737 |
| UniProt ID | O00585 |
| ◆ Recombinant Proteins | ||
| CCL-328M | Active Recombinant Mouse Chemokine (C-C Motif) Ligand 21A (Serine) | +Inquiry |
| CCL21-0626H | Recombinant Human CCL21 Protein, GST-Tagged | +Inquiry |
| CCL21-10843H | Recombinant Human CCL21, GST-tagged | +Inquiry |
| CCL-329H | Recombinant Human Chemokine (C-C Motif) Ligand 21, His-tagged | +Inquiry |
| CCL21-513R | Recombinant Rhesus Macaque CCL21 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL21-552HCL | Recombinant Human CCL21 cell lysate | +Inquiry |
| CCL21-424CCL | Recombinant Cynomolgus CCL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL21 Products
Required fields are marked with *
My Review for All CCL21 Products
Required fields are marked with *
