Recombinant Human CCL21 protein, GST-tagged

• Cat.No.: CCL21-2653H
• Product Overview: Recombinant Human CCL21 protein(O00585)(24-134aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 24-134aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.3 kDa
• AA Sequence: SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CCL21 chemokine (C-C motif) ligand 21 [ Homo sapiens ]
• Official Symbol: CCL21
• Synonyms: CCL21; chemokine (C-C motif) ligand 21; SCYA21, small inducible cytokine subfamily A (Cys Cys), member 21; C-C motif chemokine 21; 6Ckine; beta chemokine exodus 2; CKb9; ECL; Efficient Chemoattractant for Lymphocytes; exodus 2; secondary lymphoid tissue chemokine; SLC; TCA4; exodus-2; beta chemokine exodus-2; beta-chemokine exodus-2; small-inducible cytokine A21; secondary lymphoid-tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21; SCYA21; MGC34555
• Gene ID: 6366
• mRNA Refseq: NM_002989
• Protein Refseq: NP_002980
• MIM: 602737
• UniProt ID: O00585