Recombinant Human CCL26 protein

Cat.No. : CCL26-608H
Product Overview : Recombinant Human CCL26 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 71
Description : CCL26 is novel CC family chemokine, also known as TARC (thymus and activation regulated chemokine). It is encoded by CCL26 gene, which is located on Chr.7 in humans, and ubiquitously expressed at low levels in various tissues including heart and ovary. CCL26 elicits its effects activity by binding to the cell surface chemokine receptor CCR3, and chemotactic for eosinophils and basophils.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CCR3 transfected HEK293 cells is in a concentration range of 0.5-2.0 μg/ml.
Molecular Mass : Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 71 amino acid residues.
AA Sequence : TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Endotoxin : Less than 1 EU/μg of rHuEotaxin-3/CCL26 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL26
Official Symbol CCL26
Synonyms CCL26; chemokine (C-C motif) ligand 26; SCYA26, small inducible cytokine subfamily A (Cys Cys), member 26; C-C motif chemokine 26; CC chemokine IMAC; chemokine N1; eotaxin 3; IMAC; macrophage inflammatory protein 4 alpha; MIP 4a; MIP 4alpha; small inducible cytokine A26; thymic stroma chemokine 1; TSC 1; eotaxin-3; MIP-4-alpha; thymic stroma chemokine-1; small-inducible cytokine A26; macrophage inflammatory protein 4-alpha; small inducible cytokine subfamily A (Cys-Cys), member 26; TSC-1; MIP-4a; SCYA26; MIP-4alpha; MGC126714;
Gene ID 10344
mRNA Refseq NM_006072
Protein Refseq NP_006063
MIM 604697
UniProt ID Q9Y258

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL26 Products

Required fields are marked with *

My Review for All CCL26 Products

Required fields are marked with *

0
cart-icon