Recombinant Human CCL28 Protein, Biotinylated
Cat.No. : | CCL28-019H |
Product Overview : | Biotinylated Recombinant human CCL28 protein was tag free expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 127 |
Description : | This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene. |
Form : | Lyophilized |
AA Sequence : | MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Purity : | > 97% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered and lyophilized. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Conjugation : | Biotin |
Gene Name | CCL28 chemokine (C-C motif) ligand 28 [ Homo sapiens (human) ] |
Official Symbol | CCL28 |
Synonyms | CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; CCK1; MEC; mucosae associated epithelial chemokine; SCYA28; small inducible cytokine A28; small inducible cytokine subfamily A (Cys Cys); member 28; small-inducible cytokine A28; mucosae-associated epithelial chemokine; chemokine (C-C motif) ligand 28 splice variant chi; small inducible cytokine subfamily A (Cys-Cys), member 28; MGC71902; |
Gene ID | 56477 |
mRNA Refseq | NM_148672 |
Protein Refseq | NP_683513 |
MIM | 605240 |
UniProt ID | Q9NRJ3 |
◆ Recombinant Proteins | ||
CCL28-145H | Active Recombinant Human CCL28, MIgG2a Fc-tagged | +Inquiry |
CCL28-077C | Active Recombinant Human CCL28 Protein (108 aa) | +Inquiry |
CCL28-179H | Recombinant Human CCL28 Protein, Mature chain, Tag Free, Biotinylated | +Inquiry |
CCL28-1395M | Recombinant Mouse CCL28 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL28-27825TH | Recombinant Human CCL28 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL28-7724HCL | Recombinant Human CCL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL28 Products
Required fields are marked with *
My Review for All CCL28 Products
Required fields are marked with *