Recombinant Rat Ccl28 protein
Cat.No. : | Ccl28-639R |
Product Overview : | Recombinant Rat Ccl28 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 116 |
Description : | CCL28 belongs to CC family chemokine, also named mucosae-associated epithelial chemokine (MEC). The CCL28 mRNA is highly expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. The protein signals through CCR3 and CCR10, and chemotactic for resting CD4, CD8 T-cells and eosinophils. CCL28 shares the most homology with CCL27/CTACK. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 200 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 5.0-50 ng/ml. |
Molecular Mass : | Approximately 13.1 kDa, a single non-glycosylated polypeptide chain containing 116 amino acids. |
AA Sequence : | SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR |
Endotoxin : | Less than 1 EU/µg of rRtMEC/CCL28 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl28 |
Official Symbol | Ccl28 |
Synonyms | CCL28; chemokine (C-C motif) ligand 28; C-C motif chemokine 28; CC chemokine CCL28; Scya28; |
Gene ID | 114492 |
mRNA Refseq | NM_053700 |
Protein Refseq | NP_446152 |
UniProt ID | Q91Y39 |
◆ Recombinant Proteins | ||
Ccl28-152M | Active Recombinant Mouse Ccl28 Protein | +Inquiry |
Ccl28-639R | Recombinant Rat Ccl28 protein | +Inquiry |
CCL28-077C | Active Recombinant Human CCL28 Protein (108 aa) | +Inquiry |
CCL28-2974M | Recombinant Mouse CCL28 Protein | +Inquiry |
CCL28-149H | Active Recombinant Human CCL28, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL28-7724HCL | Recombinant Human CCL28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl28 Products
Required fields are marked with *
My Review for All Ccl28 Products
Required fields are marked with *
0
Inquiry Basket