Recombinant Human CCL4 protein

Cat.No. : CCL4-294H
Product Overview : Recombinant Human CCL4 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 69
Description : CCL4 encoded by the CCL4 gene, also known as Macrophage Inflammatory Protein-1β (MIP-1β) is a CC chemokine with specificity for CCR5 receptors and it is a major HIV-suppressive factor produced by CD8+ T cells. It is a monokine with inflammatory and chemokinetic properties. Recombinant CCL4 induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). Specifically, MIP-1-beta (3-69) is also a ligand for CCR1 and CCR2 isoform B. Recombinant human CCL4 contains 69 amino acids and it shares 77 % and 80 % a.a. sequence identity with murine and rat CCL4, respectively. Both human and murine MIP-1α and MIP-1β are active on human and murine hematopoietic cells.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 5.0-20 ng/ml.
Molecular Mass : Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
AA Sequence : APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Endotoxin : Less than 1 EU/μg of rHuMIP-1β/CCL4 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL4
Official Symbol CCL4
Synonyms CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026;
Gene ID 6351
mRNA Refseq NM_002984
Protein Refseq NP_002975
MIM 182284
UniProt ID P13236

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL4 Products

Required fields are marked with *

My Review for All CCL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon