Recombinant Human CCL5 Protein, GST-Tagged

Cat.No. : CCL5-0642H
Product Overview : Human CCL5 full-length ORF (AAH08600, 1 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]
Molecular Mass : 35.75 kDa
AA Sequence : MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCL5 chemokine (C-C motif) ligand 5 [ Homo sapiens ]
Official Symbol CCL5
Synonyms CCL5; chemokine (C-C motif) ligand 5; D17S136E, SCYA5, small inducible cytokine A5 (RANTES); C-C motif chemokine 5; beta chemokine RANTES; MGC17164; RANTES; regulated upon activation; normally T expressed; and presumably secreted; SIS delta; SISd; small inducible cytokine subfamily A (Cys Cys); member 5; T cell specific protein p288; T cell specific RANTES protein; TCP228; eoCP; SIS-delta; beta-chemokine RANTES; small-inducible cytokine A5; T-cell specific protein p288; t cell-specific protein P228; T-cell-specific protein RANTES; eosinophil chemotactic cytokine; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted; SCYA5; D17S136E;
Gene ID 6352
mRNA Refseq NM_002985
Protein Refseq NP_002976
MIM 187011
UniProt ID P13501

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL5 Products

Required fields are marked with *

My Review for All CCL5 Products

Required fields are marked with *

0
cart-icon
0
compare icon