Recombinant Human CCR1 protein, His-SUMO-tagged
Cat.No. : | CCR1-6213H |
Product Overview : | Recombinant Human CCR1 protein(P32246)(306-355aa), fused with N-terminal His-SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 306-355aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF |
Gene Name | CCR1 chemokine (C-C motif) receptor 1 [ Homo sapiens ] |
Official Symbol | CCR1 |
Synonyms | CCR1; chemokine (C-C motif) receptor 1; CMKBR1, SCYAR1; C-C chemokine receptor type 1; CD191; CKR 1; MIP1aR; CCR-1; CC-CKR-1; RANTES-R; C-C CKR-1; MIP-1alpha-R; LD78 receptor; RANTES receptor; macrophage inflammatory protein 1-alpha receptor; CKR1; CKR-1; HM145; CMKBR1; SCYAR1; |
Gene ID | 1230 |
mRNA Refseq | NM_001295 |
Protein Refseq | NP_001286 |
MIM | 601159 |
UniProt ID | P32246 |
◆ Cell & Tissue Lysates | ||
CCR1-7698HCL | Recombinant Human CCR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR1 Products
Required fields are marked with *
My Review for All CCR1 Products
Required fields are marked with *
0
Inquiry Basket