Recombinant Human CCR1 protein, His-SUMO-tagged

Cat.No. : CCR1-6213H
Product Overview : Recombinant Human CCR1 protein(P32246)(306-355aa), fused with N-terminal His-SUMO tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 306-355aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.9 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
Gene Name CCR1 chemokine (C-C motif) receptor 1 [ Homo sapiens ]
Official Symbol CCR1
Synonyms CCR1; chemokine (C-C motif) receptor 1; CMKBR1, SCYAR1; C-C chemokine receptor type 1; CD191; CKR 1; MIP1aR; CCR-1; CC-CKR-1; RANTES-R; C-C CKR-1; MIP-1alpha-R; LD78 receptor; RANTES receptor; macrophage inflammatory protein 1-alpha receptor; CKR1; CKR-1; HM145; CMKBR1; SCYAR1;
Gene ID 1230
mRNA Refseq NM_001295
Protein Refseq NP_001286
MIM 601159
UniProt ID P32246

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCR1 Products

Required fields are marked with *

My Review for All CCR1 Products

Required fields are marked with *

0
cart-icon