Recombinant Human CCS Protein, GST-Tagged
| Cat.No. : | CCS-0707H |
| Product Overview : | Human CCS full-length ORF (NP_005116.1, 1 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 55.4 kDa |
| AA Sequence : | MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCS copper chaperone for superoxide dismutase [ Homo sapiens ] |
| Official Symbol | CCS |
| Synonyms | CCS; copper chaperone for superoxide dismutase; superoxide dismutase copper chaperone; MGC138260; |
| Gene ID | 9973 |
| mRNA Refseq | NM_005125 |
| Protein Refseq | NP_005116 |
| MIM | 603864 |
| UniProt ID | O14618 |
| ◆ Recombinant Proteins | ||
| CCS-0707H | Recombinant Human CCS Protein, GST-Tagged | +Inquiry |
| Ccs-2631M | Recombinant Mouse Ccs protein, His & T7-tagged | +Inquiry |
| CCS-314H | Recombinant Human CCS protein, His-tagged | +Inquiry |
| CCS-3038HF | Recombinant Full Length Human CCS Protein, GST-tagged | +Inquiry |
| CCS-315H | Recombinant Human CCS protein, His-T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCS-312HCL | Recombinant Human CCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCS Products
Required fields are marked with *
My Review for All CCS Products
Required fields are marked with *



