Recombinant Human CD163 Protein, GST-Tagged
Cat.No. : | CD163-0726H |
Product Overview : | Human CD163 partial ORF (NP_004235, 78 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the scavenger receptor cysteine-rich (SRCR) superfamily, and is exclusively expressed in monocytes and macrophages. It functions as an acute phase-regulated receptor involved in the clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages, and may thereby protect tissues from free hemoglobin-mediated oxidative damage. This protein may also function as an innate immune sensor for bacteria and inducer of local inflammation. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011] |
Molecular Mass : | 35.75 kDa |
AA Sequence : | NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD163 CD163 molecule [ Homo sapiens ] |
Official Symbol | CD163 |
Synonyms | CD163; CD163 molecule; CD163 antigen; scavenger receptor cysteine-rich type 1 protein M130; M130; MM130; hemoglobin scavenger receptor; macrophage-associated antigen; |
Gene ID | 9332 |
mRNA Refseq | NM_004244 |
Protein Refseq | NP_004235 |
MIM | 605545 |
UniProt ID | Q86VB7 |
◆ Recombinant Proteins | ||
CD163-125H | Recombinant Human CD163 Protein, His-tagged | +Inquiry |
CD163-1667M | Recombinant Mouse CD163 Protein (86-365 aa), His-tagged | +Inquiry |
CD163-5324H | Recombinant Human CD163 Protein (Thr41-Ser1045), C-His tagged | +Inquiry |
CD163-356H | Recombinant Human CD163 protein, His-tagged | +Inquiry |
CD163-112H | Active Recombinant Human CD163, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD163-7683HCL | Recombinant Human CD163 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD163 Products
Required fields are marked with *
My Review for All CD163 Products
Required fields are marked with *