Recombinant Human CD163 protein, His&Myc-tagged
Cat.No. : | CD163-6463H |
Product Overview : | Recombinant Human CD163 protein(Q86VB7)(51-366aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 51-366a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAIWQCKHHEWGKHYCNHNEDAGVTCS |
Gene Name | CD163 CD163 molecule [ Homo sapiens ] |
Official Symbol | CD163 |
Synonyms | CD163; CD163 molecule; CD163 antigen; scavenger receptor cysteine-rich type 1 protein M130; M130; MM130; hemoglobin scavenger receptor; macrophage-associated antigen; |
Gene ID | 9332 |
mRNA Refseq | NM_004244 |
Protein Refseq | NP_004235 |
MIM | 605545 |
UniProt ID | Q86VB7 |
◆ Recombinant Proteins | ||
CD163-1405H | Recombinant Human CD163 Protein (Gly46-Gly401), N-His tagged | +Inquiry |
CD163-6755H | Recombinant Human CD163 protein, His-Avi-tagged | +Inquiry |
CD163-125H | Recombinant Human CD163 Protein, His-tagged | +Inquiry |
CD163-1022M | Recombinant Mouse CD163 Protein (86-365 aa), His-tagged | +Inquiry |
CD163-034H | Recombinant Human CD163 Protein, Ser42-Ser1045, C-His-Avi tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD163-7683HCL | Recombinant Human CD163 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD163 Products
Required fields are marked with *
My Review for All CD163 Products
Required fields are marked with *