Recombinant Human CD247 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CD247-2726H |
Product Overview : | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Molecular Mass : | 18.7 kDa |
AA Sequence : | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CD247 CD247 molecule [ Homo sapiens (human) ] |
Official Symbol | CD247 |
Synonyms | CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex), CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3; T3Z; CD3Z; TCRZ; CD3-ZETA; |
Gene ID | 919 |
mRNA Refseq | NM_000734 |
Protein Refseq | NP_000725 |
MIM | 186780 |
UniProt ID | P20963 |
◆ Recombinant Proteins | ||
CD247-0290H | Recombinant Human CD247 protein, GST-tagged | +Inquiry |
CD247-5889Z | Recombinant Zebrafish CD247 | +Inquiry |
CD247-1291HFL | Recombinant Full Length Human CD247 Protein, C-Flag-tagged | +Inquiry |
CD247-3088HF | Recombinant Full Length Human CD247 Protein, GST-tagged | +Inquiry |
CD247-7090H | Recombinant Human CD247, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *
0
Inquiry Basket