Recombinant Human CD247 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CD247-2726H |
| Product Overview : | CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Molecular Mass : | 18.7 kDa |
| AA Sequence : | MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CD247 CD247 molecule [ Homo sapiens (human) ] |
| Official Symbol | CD247 |
| Synonyms | CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex), CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3; T3Z; CD3Z; TCRZ; CD3-ZETA; |
| Gene ID | 919 |
| mRNA Refseq | NM_000734 |
| Protein Refseq | NP_000725 |
| MIM | 186780 |
| UniProt ID | P20963 |
| ◆ Recombinant Proteins | ||
| CD247-1291HFL | Recombinant Full Length Human CD247 Protein, C-Flag-tagged | +Inquiry |
| CD247-2726H | Recombinant Human CD247 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Cd247-840M | Recombinant Mouse Cd247 Protein, MYC/DDK-tagged | +Inquiry |
| CD247-536H | Recombinant Human CD247 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD247-134C | Recombinant Cynomolgus Monkey CD247 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD247 Products
Required fields are marked with *
My Review for All CD247 Products
Required fields are marked with *



