Recombinant Human CD247 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CD247-2726H
Product Overview : CD247 MS Standard C13 and N15-labeled recombinant protein (NP_000725) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Mass : 18.7 kDa
AA Sequence : MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CD247 CD247 molecule [ Homo sapiens (human) ]
Official Symbol CD247
Synonyms CD247; CD247 molecule; CD3Z, CD3z antigen, zeta polypeptide (TiT3 complex), CD247 antigen; T-cell surface glycoprotein CD3 zeta chain; CD3H; CD3Q; CD3zeta chain; TCR zeta chain; CD247 antigen, zeta subunit; T-cell receptor T3 zeta chain; CD3Z antigen, zeta polypeptide (TiT3 complex); T-cell antigen receptor complex, zeta subunit of CD3; T3Z; CD3Z; TCRZ; CD3-ZETA;
Gene ID 919
mRNA Refseq NM_000734
Protein Refseq NP_000725
MIM 186780
UniProt ID P20963

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD247 Products

Required fields are marked with *

My Review for All CD247 Products

Required fields are marked with *

0
cart-icon